• PREMIUM
AI843
search
  • AI843

RB250

Antibody name : RB250

Data sheet

Antigen type
Protein
Antigen ID (TGP)
Q9NZ45
Q91WS0
Target Name
CISD1¸ C10orf70¸ ZCD1¸ CDGSH iron-sulfur domain-containing protein 1¸ MitoNEET
Epitope
Sequence:KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Applications
ELISA
Immunofluorescence
PMID
28716905
Antibody clone name
RB250
Rating
5
DOI
10.24450/journals/abrep.2018.e1
Value
Guinea pig IgG
Human IgG1
Human IgG2
Mouse IgG1
Mouse IgG2
Rabbit IgG

Antigen

Antigen type : Protein
Antigen ID : Q9NZ45
Antigen ID : Q91WS0

Antigen name : CISD1¸ C10orf70¸ ZCD1¸ CDGSH iron-sulfur domain-containing protein 1¸ MitoNEET
Epitope : Sequence:KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Applications

ELISA
Immunofluorescence

Publications

PubMed : 28716905
DOI : 10.24450/journals/abrep.2018.e1

Product Description

100 µg of antibody (serum free cell supernatant)
(+0.02% sodium azide)

Product Rating

Premium antibody; shipping time 1-10 working days, depending on antibody Fc format

CHF200.00
Antibody Format
Quantity